Protein Info for Shew_0038 in Shewanella loihica PV-4

Annotation: excinuclease ABC subunit C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 PF01541: GIY-YIG" amino acids 11 to 84 (74 residues), 58.9 bits, see alignment E=2.5e-20

Best Hits

Swiss-Prot: 55% identical to Y3545_CROS8: UPF0213 protein ESA_03545 (ESA_03545) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K07461, putative endonuclease (inferred from 100% identity to slo:Shew_0038)

Predicted SEED Role

"COG2827: putative endonuclease containing a URI domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8W3 at UniProt or InterPro

Protein Sequence (97 amino acids)

>Shew_0038 excinuclease ABC subunit C (RefSeq) (Shewanella loihica PV-4)
MPQEKLASTTWSLYMIRCANGHLYTGITTDIDRRFKEHSDNGPKTAKYLRGKGPLTLVYH
EQVGCRSDALKREIAVKRLTKTQKVALIHFDANGECP