Protein Info for Shew_0037 in Shewanella loihica PV-4

Annotation: phosphoesterase, PA-phosphatase related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF01569: PAP2" amino acids 89 to 202 (114 residues), 91 bits, see alignment E=5.5e-30 PF14378: PAP2_3" amino acids 132 to 196 (65 residues), 27.3 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0037)

Predicted SEED Role

"FIG01286086: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8W2 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shew_0037 phosphoesterase, PA-phosphatase related (RefSeq) (Shewanella loihica PV-4)
MNLQQQAKAMGMPAQDKYQGRGFIGLLLFLLCLHLLVLNSAVNLSLFRFFNGIAAYAPAD
LLLLITDLGDGITLGVITLCCLVKRPELLLRVVIASVLSLILVPLLKQTFDAPRPAVILE
TLNIVGEIRLKHSFPSGHTATAFLFAGTLFFAYRQTQIKCLAIAFASLVGLSRIVVGAHW
PEDVIMGAFVGLFCAYAAAHCPLVKLTQFHKALILAFLWCVLVVSELDKSFDKDHIWPIL
MLRWGLIATAALLIWREYGAMHRVRRWLAFQG