Protein Info for Shew_0032 in Shewanella loihica PV-4

Annotation: hydrophobe/amphiphile efflux-1 (HAE1) family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1049 transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details amino acids 470 to 494 (25 residues), see Phobius details amino acids 540 to 558 (19 residues), see Phobius details amino acids 661 to 679 (19 residues), see Phobius details amino acids 872 to 890 (19 residues), see Phobius details amino acids 896 to 916 (21 residues), see Phobius details amino acids 928 to 941 (14 residues), see Phobius details amino acids 972 to 992 (21 residues), see Phobius details amino acids 1004 to 1026 (23 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1026 (1026 residues), 1307.1 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1041 (1041 residues), 1730.2 bits, see alignment E=0 PF03176: MMPL" amino acids 336 to 499 (164 residues), 24.6 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 64% identical to ACRB_ECOLI: Multidrug efflux pump subunit AcrB (acrB) from Escherichia coli (strain K12)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 66% identity to abo:ABO_0964)

MetaCyc: 60% identical to multidrug efflux pump RND permease AcrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-360

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8V7 at UniProt or InterPro

Protein Sequence (1049 amino acids)

>Shew_0032 hydrophobe/amphiphile efflux-1 (HAE1) family protein (RefSeq) (Shewanella loihica PV-4)
MARFFIDRPIFAWVIAIIVMLAGVLSIMKLPVSQYPSIAPPTVVINAIYPGASAKTMEDT
VTQVIEQRMTGIDHLRYISSTSDSFGNAQITLTFNAEADPDIAQVQVQNKLQLAMPLLPQ
EVQAQGVKVNKSSSGFLMVLGFVSQDGSLEKNDISDYVGSNILDPMSRVPGVGEIQLFGA
QYAMRIWLDPLKLTQYNLTSLDIMASIREQNAQVSAGQLGGAPSIAGQELNATVTAQSRL
QTAEEFRKIIIKSDPSGAKVYLEDVARVELGSESYSVESFYNGRPAAGLAIKLATGANAL
ATAERVREKVDEMKPFFPQGLEVVYPYDTTPFVEKSIEGVVHTLLEAVVLVFVIMYLFLQ
NFRATLIPTIAVPVVLLGTFAILSATGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVM
SEDGLSPIEATKKSMDQITGALVGIGLTLSAVFVPMAFMSGSTGVIYRQFSVTIVSAMAL
SVLVAIILTPALCATMLKPIAKGHHAVETGFFGWFNRTFDKMTSRYEAGVAAMIKRAGRV
MLIYVALTVAVGWIFMRMPTAFLPDEDQGILFTQAILPTNSTQESTKKVMSKISDFYLNE
TGDSVKSVFSVSGFSFAGSGQNMGLAFVGMKDWSERTGPGQDVKSVAGRAMGMFMQMKEA
FVFAFVPPAVIELGTANGFDFYLQDRNGQGHEKLLEARNMLLGMASQNPNLVGVRPNGQE
DAPMYRIHIDHAKLRALSIDIDAVNSVLGTAWGGSYVNDFIDRGRVKKVYVQGDAQYRMQ
PEDLDTWYVRNSQGEMVPFSAFATGTWEYGSPRLERFNGLPAMNIQGGTAQGYSTGAAMA
DIEAMVAKLPPGFGVEWNGLSYEERLSGNQAPALYALSIMVVFLVLAALYESWSVPFAVI
LVVPLGIIGALLAMNGRGLPNDVFFQVGLLTTVGLATKNAILIVEFAKEFYEKGAGLVEA
TLHAVRVRLRPILMTSLAFGLGVVPLAISSGVGSGSQNAIGTGVLGGMMSSTFLGIFFIP
IFFVIVERIFSKREKKGAATQVADSTPQE