Protein Info for DVUA0077 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 63 to 87 (25 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 46 to 255 (210 residues), 76.9 bits, see alignment E=8.4e-26

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 100% identity to dvl:Dvul_3031)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WL2 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DVUA0077 ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKEHISACKGPLASHTITCVSSRRGTSLTHNPVTLLRTLVARRDLFMQLLRRDIAARYRG
TCLGWLWVLATPVLVLGVYTFVFGVIYQASRFSGGVGDYALMLFCGFVPWWLFAEVTGGA
PTLIQARPSFVQKMCFPLEILPVVHLGVSLFNSLAALVILLAALAMKGMPFHLTLLWIPA
LYVPLCLWSLGGAFLLSALGVFLRDMQHAVSVALQLLFFATPIVYQLDMVPEQWRFLLRC
NPMTEIVEAFRHVIYFGQAPEPVSLGIVTVLGACVLWVGHLVFMQARKAFADVL