Protein Info for DVUA0071 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1/2 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 PF13641: Glyco_tranf_2_3" amino acids 25 to 225 (201 residues), 53.3 bits, see alignment E=8.2e-18 PF00535: Glycos_transf_2" amino acids 28 to 152 (125 residues), 100.8 bits, see alignment E=2.1e-32 PF13692: Glyco_trans_1_4" amino acids 532 to 615 (84 residues), 52.2 bits, see alignment E=2.1e-17 PF20706: GT4-conflict" amino acids 533 to 592 (60 residues), 27.1 bits, see alignment 5.1e-10 PF00534: Glycos_transf_1" amino acids 535 to 623 (89 residues), 57.8 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0071)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WL8 at UniProt or InterPro

Protein Sequence (718 amino acids)

>DVUA0071 glycosyl transferase, group 1/2 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLKAFRKNQHPVAIPSTLPDGSAWPRISIVTPSYNNAKYIEETIISVLEQGYPDVEHIIV
DGASKDGTAAILDRYRGHVARIIQEPDTGQSNAINKGMRLATGEIVTWLNSDDLLAPGAL
AAVAMAFHMSGADMVAGGCQLYRNGGYLGTHLTSCADGTLPAEEISDLYGGWQTGKFFYQ
PEVMFTRDLWQRAGGQVREDLHYCMDVEMWLRFASCGARLHVIGAPVAMFRLHEEQKTNN
PDASPDEYIPVANAWRTTHGLPPITRTTLPPPPPPLKVAFVNDIGFQYGAGIAHQRLFTA
VSSAGHTVRGWATGFQSPRDVFEATAARIISEIEAFEPDVVVCGNLHCTIADSDMLVRLT
DRWPTCFCLHDLWLLTGHCPHPGFLDCVRHLAGCDHTCPSPDTYPTIAAGDIRKAWDAKR
EVMARDTFLALANSNWTRAQHDGCTTPGHEARLLRLGCDESIFHPGDRLEARRQLGLDMD
AFVVLMPMVDFSSPFKGSVEGLEALSGAGLENLQVICFGVVEQEMIARFPILTALGYLHD
PEAVATAYRAADVVVSFSHAETFGQTLMEAACCGIPSLAYRCTGLPDAVVDGVSGFLVDE
TPDALITRLHQLHADANLRASLGTWAALYARNSRCLQAEYHSFHTNLEEAGLLAPGRLGK
NIFFAHTEAHEAEPSIPVSDPRPGSAFKNWLRRELPTPVWMALRRVYRGTKSRLGMHP