Protein Info for DVUA0049 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: polysaccharide biosynthesis family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 258 to 286 (29 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 459 to 482 (24 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 40 to 338 (299 residues), 39.1 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0049)

Predicted SEED Role

"polysaccharide biosynthesis family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WP0 at UniProt or InterPro

Protein Sequence (489 amino acids)

>DVUA0049 polysaccharide biosynthesis family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGTSGYFARNSVIRIVSFAVGVGFALFVTPVVVGTLGKTNYGVWVLVSSVACYFLLLEGG
VMQAVSRHAAAALARDDRHEVDRVCTAGFALHALSCCLALCVTGGLALFAGVFASDQLPV
ERLRQCLVIYSVCLSLFFLFRTHTGLLMAEMRWTLIAVLAMLRSAFTSLAVLLMITPENG
LWLLAAVNGGGFLLEGAACLLFARRSGRGRVRVALFDAALARELLGYGWAFTVTQLGESM
RYRSQNYIIALFSGVREVAVFSIAMQFIGYFLSLMQSAFGIMVPYFSRMQARGDRDDTAG
SLLFALRLSYVTASFIGLCLIFYGQEFIVLWLGPGFAEAHDALVPLTLGAVFSLGMLPAD
GYLLGTARHRMLARCAMAEGVSIVLLSLALAGPFGMEGVAWAYCGVALVFRAGVVPWFVF
TQAGLPLLAYARLLAEVAVTHVAPQVLLYLIMRGTLGTGYLQLALLAGMQGVLAVGIQSS
LLRFTRGAA