Protein Info for DVUA0016 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifV
Annotation: homocitrate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF00682: HMGL-like" amino acids 22 to 261 (240 residues), 183 bits, see alignment E=4.1e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0016)

Predicted SEED Role

"Homocitrate synthase 1 (EC 2.3.3.14)" (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WS3 at UniProt or InterPro

Protein Sequence (384 amino acids)

>DVUA0016 homocitrate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAWRRRHVGLASGLQGHLRRCVMLIDSTLREGAQAYGVYFDAADRESILQGVAASGVTEA
EAGWAGQDDLAATLRLGARVAPSLRLAVWCRCCTADLDKAAEAGARRVHIGVPSSDAHMR
LRLGMGRDEVLQRVTTVLEHAAHLGFLHVTLGLEDAGRAAPDLLEALARTAARTGAHRLR
CSDTVGLLTPDGMVRLVLLARRASALPVAVHCHNDLGLATANALAALDAGADGADVSLLG
LGERAGITRAEELAAALVVLRGESYRLDMLRGVCRRLAASLEMRLPPHWAVAGENLFAVE
SGVHLHGVQRDPALFEPFPPALVGAERRLGVGGKCGSAGVAAMAHSHGLTLQGDALRRHV
RAVRDKACSLGRPLTDAEFLCAGR