Protein Info for DVUA0009 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifE
Annotation: nitrogenase MoFe cofactor biosynthesis protein NifE domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 TIGR01283: nitrogenase MoFe cofactor biosynthesis protein NifE" amino acids 35 to 463 (429 residues), 583.3 bits, see alignment E=1.5e-179 PF00148: Oxidored_nitro" amino acids 56 to 451 (396 residues), 339.8 bits, see alignment E=1.1e-105

Best Hits

KEGG orthology group: K02587, nitrogenase molybdenum-cofactor synthesis protein NifE (inferred from 100% identity to dvu:DVUA0009)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifE" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WT0 at UniProt or InterPro

Protein Sequence (568 amino acids)

>DVUA0009 nitrogenase MoFe cofactor biosynthesis protein NifE domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAPATPPATPPATPPAPASDGLLEERRGQVHRAGQGPIDLACNRESLAGAVSQRACVFCG
SRVVLYPIADALHLVHGPVGCAAYTWDIRGALSSGPELHRLSFSTDLGERDIIFGGEPKL
EAALDELITRHAPKAAFVYATCIVGLIGDDIGAVCKRVAARHGIPVLPVQSEGFKGNKRE
GYEAACAAMFTLTGTGATDGIGPASVNILGDFNLAGELWIIRGYLERMGVQVVANITGDG
RVDDLRRCHGAALNLVQCSGATMPLARMMREAYGTPTLRVSYLGIEDMADSLYNVAEHFR
EVCPGIVERTRDLVREEIATLMPRLRQLRRDLEGKRAAIYVGGAFKAFSLIKAFRHLGMQ
VALVGSQTGTDEDYRELEAICDPGTIIVDDANALELAHFVRTLDVDIFVGGVKERPIAHK
LGIGFCDHNHERKIALAGFEGMYNFAREVHASVTSPVWRFTPRSRFPAAARPEGDGHANC
PAGDEDADCPERDGHANCPEGDGQADNPADRADRHLGADAPAHERDGHPANPAGDGDADC
PANPAGHAPHDLFTEGNATEGGAHHGRP