Protein Info for DVU3227 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: flagellar basal body-associated protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 76 to 98 (23 residues), see Phobius details PF03748: FliL" amino acids 130 to 226 (97 residues), 39.6 bits, see alignment E=3.3e-14

Best Hits

KEGG orthology group: K02415, flagellar FliL protein (inferred from 100% identity to dvu:DVU3227)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726C6 at UniProt or InterPro

Protein Sequence (227 amino acids)

>DVU3227 flagellar basal body-associated protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPEDLSGKAQPDTAPLDAGLAMSRAEEKVELDLDDAPFLIPEVETPPPPPKAETSLSLDI
PEEKPAKKSLFANRKLLIIAAAVLLLLVGGGGATWWFVLRTPPEKPAGPKTVVVPSEPAP
VEVPKASTPVVSLEPFWVEQRDMDGQIRFLVCKFAAPATDPKLIHEIQGKKVVIRDAVYY
YLKNKSLVFLTDGANAETLKKDLLTIINGYLSLGKLEDLLIENYLVK