Protein Info for DVU0483 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DNA mismatch repair protein MutL, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 TIGR00585: DNA mismatch repair protein MutL" amino acids 12 to 319 (308 residues), 297.3 bits, see alignment E=9e-93 PF02518: HATPase_c" amino acids 31 to 87 (57 residues), 30.7 bits, see alignment 7.7e-11 PF13589: HATPase_c_3" amino acids 34 to 128 (95 residues), 44.7 bits, see alignment E=2.7e-15 PF01119: DNA_mis_repair" amino acids 228 to 337 (110 residues), 111.2 bits, see alignment E=4.6e-36 PF08676: MutL_C" amino acids 569 to 700 (132 residues), 105.3 bits, see alignment E=4.5e-34

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to dvu:DVU0483)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ET5 at UniProt or InterPro

Protein Sequence (744 amino acids)

>DVU0483 DNA mismatch repair protein MutL, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQPESTHQARRVIQVLPPELRNQIAAGEVVERPASVVKELVENSLDAGATAIEVVLEDGG
QSYIMVRDDGYGIPADELELAVTRHATSKVTNLAELARIMSFGFRGEALPSIASVSRFAM
TSAHAKAEGGTVATRIEVEHGRVLASGPAALHRGTIVEVRELFANIPARLKFMKTQATET
KRCQELFARIALARPDIAFTLSAGRRELLRFPAGQTLRQRLGTLWPPAVVETLYAFDRST
GTVRVHGLAADPRGAQPRPDRLLLYVNGRAVNDRLLLKAVREAYKGRLLAREYPQVVLFL
DIDPEEVDVNVHPAKNEVRFRDEREVFVAVLRAVGDAVEASAQGIPDETEPGTDPFAAPL
RPVPPAAPHARPLGFWGEADRASVLQPSGKRRPDETGHVETVLVETMGGEAASPSHTVPG
TDAPSPRTPDDVPRADVHPRMDVPPMAASSGDGTRPVRALHMAEHAAYDTGVSGFKAGTP
DSMAPRNGHASWGDATDRTLTGNAGAANDRTDDNGTAYRNAPFTDCPPGMIAPSGTAEAR
QTSPADTAPPQTYDEGLEGGVRVGDHLYLGQIADTYLVLRHGNDQLVLVDQHAAHERVLH
ARLRRGGMAGGGQLLALPIELPLHPAELERLRLLDDDLRALGFECSTSGQTLSVRAMPPV
LDRAGATSFLREALAGRRENLDDLWAMMACKAAIKAGQRLTPDEAAGLLAQWLATPEHDF
CPHGRPAVLRFNPGELERMFKRRT