Protein Info for SO0560.2 in Shewanella oneidensis MR-1

Annotation: hypothetical small-conductance mechanosensitive channel (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 293 to 314 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 345 to 380 (36 residues), 24.3 bits, see alignment 2.5e-09 PF00924: MS_channel_2nd" amino acids 381 to 429 (49 residues), 45.3 bits, see alignment 7.4e-16

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to son:SO_0560.2)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>SO0560.2 hypothetical small-conductance mechanosensitive channel (NCBI ptt file) (Shewanella oneidensis MR-1)
MRRSLILLLALSFPLLINAKVFAADPVPVTTTQTTSVSNDTEAELTTLQTAIKEDIARLA
HYQGELRTIAEYRIQNKSLQLRNKIKTLLDDDSYDKALILPLVQEQLLFNQKINDYFNDI
VSKLSQKLGTPDDEATLLEISKRELDKDNNYKQRLETLDWLSQLGQDVTAEKAQLTQILL
SRADNFDSFVTYTQQQLQNAVNDATNAGKDATSAQTSRVIQLKDRLAQNSLSLSIDIELL
DALGQNTAMLKKTLFSISGDITQDVLSVDVASSLIKQWLNTAKDQAINHGPTLVFKLFIF
CLILFVASLVGKLVKKIVSNTVSNSKLNFSKLLQDFFTSLSGKAVFTIGLLIALSQLGIE
LGPLLAGFGIAGVIIGFALQDTLSNFASGMMILIYRPYDVGDLINAAGVSGRVSHMSLVS
TTIKTLDNQ