Protein Info for SO0737.1 in Shewanella oneidensis MR-1

Annotation: hypothetical alkaline phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00245: Alk_phosphatase" amino acids 56 to 197 (142 residues), 142.4 bits, see alignment E=1.1e-45

Best Hits

KEGG orthology group: K01077, alkaline phosphatase [EC: 3.1.3.1] (inferred from 100% identity to son:SO_0737.1)

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>SO0737.1 hypothetical alkaline phosphatase (NCBI ptt file) (Shewanella oneidensis MR-1)
MNVMNIKRIAAAISCSLMTVVAHAAVLPTTQSDSQWFKDSVANVAAKAQVETKKTAKNVI
LFVGDGMGISTLTAARILQGQQQTGNQGGEEHFLSFEQFPRTALVKTYNTNQQTPDSAGT
MTAMTTGVKTKVGMLSISDTSLRGNCLSSKGNELVSLVDLANAKGLSTGVITTARLTHAT
PAAAYAKSPDRDGKAMQTCQPKRLPMVVLILLANW