Protein Info for SO3195 in Shewanella oneidensis MR-1

Annotation: hypothetical peptide transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details PF00854: PTR2" amino acids 7 to 106 (100 residues), 51 bits, see alignment E=1.1e-17 PF07690: MFS_1" amino acids 15 to 145 (131 residues), 34.4 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3195)

Predicted SEED Role

"Di/tripeptide permease YjdL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>SO3195 hypothetical peptide transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MIRLGKNEPNSPVKFALGLVLLAIGFLFMIGAVVEMGGDASAKSSMWWLVGAYFFHTMGE
LCLSPIGLSMVTKLAPLRIASLMMGAWFLFVAAANKIGGVVGSFIGHGGEKEEQLANAMA
IFSGIAITAALSGVILYFMADKLVDWMHGAESKHHNEAEALEAEIAVTAEHEAIKR