Protein Info for SO3136.1 in Shewanella oneidensis MR-1

Annotation: hypothetical two-component sensor histidine kinase protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF02743: dCache_1" amino acids 41 to 228 (188 residues), 57.7 bits, see alignment E=1.3e-19 PF00512: HisKA" amino acids 382 to 446 (65 residues), 31.8 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 100% identity to son:SO_3136.1)

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>SO3136.1 hypothetical two-component sensor histidine kinase protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLPMTPKAKQRLFMTIVLLAGLFAILKLTYWVHFYQGKIDIQQQSEKQLKELVSFLDGAL
SRYESIPHVLSTNPMLANVLNDQQNPQKVQELNLYLEEIQHVTEASDIYLIDALGIAIAA
SNWQQPFSFIGKDYSFRPYYTDAISGNLGRYYAVGTSSDKRGFYFSYPIYQQGGKGILGA
IIVKVDIADIEQQSTSIAMAGQYQFLISDPDDIVFISSVDEWRLTSLTPLTQAKQYALNA
SKRYAERPIGELIIKPQYQDDSTSSGHIYHIREGNSQAQYMDTHHLMTKAGWRVHILAPL
KPLHESMPALMLLSASIYLLLALGLLFSSERRRNLQRMQLAQSLLEQRVEERTYDLQQAN
DRLKDTQDELIQAAKLTVIGSLSASINHELNQPLAALRSYAQNTQTFLARNMQDKALDNL
KIIIELTDRLADIVGQFKSFTRKSQGTDSATDLKGCIKQALTIVQPEIDKQGVELDVLLP
EGQYQVWGDKVRLQQVFVNIMSNAIVAMQQSVIRKLSIRVNCQDKFCIRIQALACAKAKW
RKYSSLISLPASALA