Protein Info for SO4327.1 in Shewanella oneidensis MR-1

Annotation: hypothetical multidrug resistance protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 334 to 353 (20 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 386 to 409 (24 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details amino acids 522 to 544 (23 residues), see Phobius details amino acids 594 to 612 (19 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 624 (621 residues), 566.1 bits, see alignment E=1.4e-173 PF03176: MMPL" amino acids 329 to 486 (158 residues), 24.1 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4327.1)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>SO4327.1 hypothetical multidrug resistance protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRFTDIFIRRPVLAASISFLLLLLGFNALNSMQVREYPKMTNTVVTVSTSYYGADANLIQ
GFITQPLEQALAQADNVDFMTSESFLGTSKISVYMKLNTDPNGALADILAKVNSVRSQLP
KEAEDPSVEMSTGSQTSVLYISFFSDQINSSQLTDYLERVVKPQLFTIDGVAKVNLYGGI
KYAMRIWLDPARMGAFNLSASDVMQVLQANNYQSAVGQTNSVYTLFNGTADTQVATIEEL
KRLVIGSKDGLVVRLGDIADVSLEKSHDIYRALANGKEAVVIGLDVTPTANPLTVAADTR
ALLPEIERNLPPSIESSILYDSSLAIDESIKEVVKTIGEAAIIVIVVITLFLGSLRAVVI
PIVTIPLSLIGVAIIMQMFGFTLNLMTLLAMVLAIGLVVDDAIVVVENVDRHIKLGESPF
RAAIIGTREIAVPVISMTITLAAVYAPIALMGGITGSLFKEFALTLAGSVFISGIVALTL
SPMMCAKILKPHTTPNRFEMGVENFLTGLTRRYSNMLDAVMLHRPVIVAFAIIVFASLPV
LFKFIPSELAPNEDKGVVMMMGTAPSTANLDYIQANMGLVTDMIKAQPESAASLAFVGVP
SSSQAFGIAPLVPWSERDKSPKTNAGVFC