Protein Info for SO0207 in Shewanella oneidensis MR-1

Name: murI
Annotation: glutamate racemase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR00067: glutamate racemase" amino acids 34 to 257 (224 residues), 243.9 bits, see alignment E=8.6e-77 PF01177: Asp_Glu_race" amino acids 48 to 242 (195 residues), 90.3 bits, see alignment E=7.9e-30

Best Hits

Swiss-Prot: 100% identical to MURI_SHEON: Glutamate racemase (murI) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to son:SO_0207)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK90 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SO0207 glutamate racemase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSILVLRFDQTCGKIRPRIGQSNSLETGLSQPILVFDSGIGGLSVLAEIRKRLPHHDYC
YVFDNARLPYGELEEQELVSGCVALISQLVERTHACIVVVACNTASTVVLPALRAKLHIP
VVGVVPAIKPAALLSKSKRIGLLATPGTVKRHYTHELISQFADDCHVELFGCSELVMMAE
HKIATGQLGIARLTQILSPVVDANLDVLVLGCTHFPMLRDELQQVLGLGVTLLDSGAAIA
KRVDTLLAHGKNISHNSEYERNGSLMRAFYTKAEITEGLATTLADCGFSTLERITTINSN
SD