Protein Info for Dshi_4217 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, LacI family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00356: LacI" amino acids 9 to 54 (46 residues), 49.5 bits, see alignment 4.3e-17 PF00532: Peripla_BP_1" amino acids 67 to 309 (243 residues), 77.7 bits, see alignment E=1.6e-25 PF13377: Peripla_BP_3" amino acids 175 to 335 (161 residues), 98 bits, see alignment E=1e-31

Best Hits

Swiss-Prot: 38% identical to GNTR_ECOL6: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to dsh:Dshi_4217)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LUL0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Dshi_4217 transcriptional regulator, LacI family (RefSeq) (Dinoroseobacter shibae DFL-12)
MPDGDSRPTLKHVAARAGVSLISASRVMRGAPNVSEALRAKVEAAAADLGYSRNRIAGSL
RSQASDLIAVIVPSMSNHVFPPIVDGIDTALRGSRFRPVLGMTGYETSMEETILRDLLSW
TPAAVILSGLEHSPGTRALLRRHDGPVIELLDTDAPPIDLSVGVSQAAAGRMMAAHLIDR
GYSRIGFVGAWGGRDTRATKRQDALARAVAAAGLAPLAQHIADAPSSLCVGADALRALRR
AHPELDAVVFANDDLALGALFACQSDGIAVPDTLALAGFNGLDMCQVITPRLTTIQTPRF
EIGQQAGTLLRDRLSGKDTPPPAPLPLHLVAGETT