Protein Info for Dshi_4192 in Dinoroseobacter shibae DFL-12

Annotation: Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details PF04290: DctQ" amino acids 55 to 183 (129 residues), 98.7 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_4192)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LUI5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dshi_4192 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq) (Dinoroseobacter shibae DFL-12)
MTQPDTDRDAEALAARLDQSARRMELADPDAGLGRLDRAINRVVEAIGVLALVLIVGVVF
ANASARYLLNFSFTWAEELVQMTIPWLAMSGVFLSVRRGTVIRIDFFYEKMPARLRPVVA
RAGLAFNCLVLAVMAYVSFDFVRLFGGDKTLYVGLPTGVSTSALVFGAAGVAMAYAAAFV
SAFLGRTTNRNGHTP