Protein Info for Dshi_4156 in Dinoroseobacter shibae DFL-12

Annotation: GAF modulated sigma54 specific transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 PF01590: GAF" amino acids 68 to 205 (138 residues), 35.4 bits, see alignment E=3e-12 PF00158: Sigma54_activat" amino acids 331 to 386 (56 residues), 27.6 bits, see alignment 4.5e-10 amino acids 396 to 453 (58 residues), 20.7 bits, see alignment 5.7e-08 PF14532: Sigma54_activ_2" amino acids 335 to 462 (128 residues), 54.4 bits, see alignment E=3.3e-18 PF02954: HTH_8" amino acids 548 to 575 (28 residues), 31.1 bits, see alignment (E = 3.2e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_4156)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LUE9 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Dshi_4156 GAF modulated sigma54 specific transcriptional regulator, Fis family (RefSeq) (Dinoroseobacter shibae DFL-12)
MGDLAHVTEIDRVVSGRAQGSLRDAVVTESWRRCVESYGLNPTATDAPHIVTDAELRAHR
EQAERLIAVARSGLQGLFKQVAGHNYVLLLADAQGVCVDFFGDPRFEDELRSAGLYLGSN
WQEELAGTCGVGSCIVTGEAVTIHQDDHFGLAHTPLSCTAAPIYDSLGQLSAVLDISLLR
SPTPKSSQNLAMSLVKASARRVEMANLMATARQDWVLRFSTSPEFLEVDPEAAVSLDGAG
RITGLTHAAQAALGATDPGALLGTRIDALMEMSIDDLPDLMRGRPTEERVLRLRDGRGVF
GHAIAPQAPRTPRPAAVPEMPAPLAGFAGPDPVLTPLLRRLGQLAGTEVPLLLLGETGTG
KERLARAVHLSGPAGRGFTVLRCAGLGRDPLPEPPAGTLFLRGVEDLDTAGQGAVLALLE
ARPDLRAIASARTDISAAVKAGAFRSDLFFRLAGHVAHLPPLRLRHDLEWLLTRLMRRHV
ARDLSLSPAARAELSARNWPGNIRELQSTLDVAAALAEGRVIDLPDLPGPSLPEAAAAPP
EADLQSLLDACGWNMSQAARRLGVNRSTVLRRVRKAGLTPPS