Protein Info for Dshi_4120 in Dinoroseobacter shibae DFL-12
Annotation: sugar transferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_4120)Predicted SEED Role
"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)
MetaCyc Pathways
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (1/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (1/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (1/9 steps found)
- succinoglycan biosynthesis (1/14 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.6
Use Curated BLAST to search for 2.7.8.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LUC0 at UniProt or InterPro
Protein Sequence (202 amino acids)
>Dshi_4120 sugar transferase (RefSeq) (Dinoroseobacter shibae DFL-12) MTPGKRALDLILALVLGIVLGPVIAGLALWLRLSQGAPVFHAAERMTTPERGFTLWKFRT MTVAAADSGVSGGDKAARITPAGRWLRRTRLDELPQLWNILRGDLSFVGPRPPLREYVER FPELYGRVLRSRPGVTGLATLTYHAHEERLLAACADPAETDAVYARACVPRKARLDLIYA AHRSVCFDLVLIARTAGRVLGR