Protein Info for Dshi_4103 in Dinoroseobacter shibae DFL-12

Annotation: parB-like partition protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR03454: plasmid partitioning protein RepB" amino acids 4 to 271 (268 residues), 201.6 bits, see alignment E=2.2e-63 PF02195: ParBc" amino acids 15 to 82 (68 residues), 63.4 bits, see alignment E=9.1e-22 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 17 to 168 (152 residues), 96.8 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to dsh:Dshi_4103)

Predicted SEED Role

"Plasmid replication protein RepB" in subsystem Plasmid replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LUA3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Dshi_4103 parB-like partition protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MQIVTEGRLDDRLQIEVEGLKNSISKNGQRVPVLVRPLEGDRYNLIYGRRRLEACRELGI
KVRAIVTEVEGDQALRDQLLENQERRDLSFIERALVATALLDGDHLEGAERTNRGVAEVL
NLHEAGVSQLLSVVRTVGEELIQAIGAAPGIGRPRWEELKKALGAYDGDRDQLQAAAHAA
KSESSGSVDEVSDRAFLAVLEAAKSAERKAGSPRKGAPALEIPGVGAATVKTGRQGKQLK
LDLTTDEPEFVSWLEGNASKLITELHERWKRSGD