Protein Info for Dshi_4011 in Dinoroseobacter shibae DFL-12
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to YHAV_ECOL6: Toxin YhaV (yhaV) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_4011)MetaCyc: 46% identical to ribosome-dependent mRNA interferase toxin YhaV (Escherichia coli K-12 substr. MG1655)
Physarum polycephalum ribonuclease. [EC: 3.1.26.1]
Predicted SEED Role
"FIG01026644: hypothetical protein"
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.26.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LU30 at UniProt or InterPro
Protein Sequence (172 amino acids)
>Dshi_4011 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12) MSGDSVPAQAPLVVNGWSIYAHPLFLDQLEGLIEEVEARKARDPKTWRKKNPTKRLAAIF KLVTEAIPVDPGAAAFRQGGTLGDHRKHWFRAKFFQQYRLFYRFNSDAKVIVVAWVNDDK TLRAYGSKTDAYATFKGMLEDGNPPDNFDALLKEAAAANKRFETSLEAAPDR