Protein Info for Dshi_3925 in Dinoroseobacter shibae DFL-12

Annotation: peptidase C26 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF07722: Peptidase_C26" amino acids 44 to 200 (157 residues), 159 bits, see alignment E=1.5e-50 PF00117: GATase" amino acids 84 to 216 (133 residues), 63.6 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to dsh:Dshi_3925)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTT6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Dshi_3925 peptidase C26 (RefSeq) (Dinoroseobacter shibae DFL-12)
MTRPLIGVTTSSRSGWRVFPFINLNLWLTGGRGLRWGAGRPADLDKVDGIVIGGGDDISP
ELYGTEVLTTARLDPARDALEHGLAREALIRNIPVLGICRGAQMLNVAAGGSLHQNAWQV
HPTSRPVKTVLPKRMVEVQANARLALIAGTEPMRVNALHSQAVDRLGDGFRVAARDTGGM
VQAIERVEDPFALGVQWHPEYLVYARRQRAIFRALVTAARARAQHRLQTPDVTRDALTAG