Protein Info for Dshi_3925 in Dinoroseobacter shibae DFL-12
Annotation: peptidase C26 (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to dsh:Dshi_3925)Predicted SEED Role
"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)
MetaCyc Pathways
- superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
- L-citrulline biosynthesis (7/8 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- superpathway of L-citrulline metabolism (9/12 steps found)
- L-glutamine degradation I (1/1 steps found)
- 4-aminobenzoate biosynthesis I (1/2 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
- superpathway of candicidin biosynthesis (3/11 steps found)
- chloramphenicol biosynthesis (1/9 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.6.1.85
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LTT6 at UniProt or InterPro
Protein Sequence (240 amino acids)
>Dshi_3925 peptidase C26 (RefSeq) (Dinoroseobacter shibae DFL-12) MTRPLIGVTTSSRSGWRVFPFINLNLWLTGGRGLRWGAGRPADLDKVDGIVIGGGDDISP ELYGTEVLTTARLDPARDALEHGLAREALIRNIPVLGICRGAQMLNVAAGGSLHQNAWQV HPTSRPVKTVLPKRMVEVQANARLALIAGTEPMRVNALHSQAVDRLGDGFRVAARDTGGM VQAIERVEDPFALGVQWHPEYLVYARRQRAIFRALVTAARARAQHRLQTPDVTRDALTAG