Protein Info for Dshi_3922 in Dinoroseobacter shibae DFL-12

Annotation: transport protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 32 to 269 (238 residues), 159.4 bits, see alignment E=5.2e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3922)

Predicted SEED Role

"Putative transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTT3 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Dshi_3922 transport protein, putative (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDRTDLAEAAIETEDEQRTVERATAMPSRLVFETIRQSGDEELRRPAMALAFSGVAAGL
LIAFSVLGEALLRANLPDAPWRYILENFGYSLGFLLVILGRMQLFTENTITTVVPVLITP
TAEMFGKVASLWGIVLLANVVGAFAAGAFLLGAPVLSPEVAEAVMELSRHATGMGAVEGF
ARGIPAGVLIAALVWMLPVARGNELALIVLFTWLIALGDFTHIIAGSVEMAYVLLAGELG
LGQALLGFFVPVLAGNVVGGTVVFTMLAWAQTRAEISED