Protein Info for Dshi_3900 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 228 to 245 (18 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details PF00106: adh_short" amino acids 5 to 189 (185 residues), 148.8 bits, see alignment E=2.8e-47 PF08659: KR" amino acids 8 to 167 (160 residues), 53.9 bits, see alignment E=4.5e-18 PF13561: adh_short_C2" amino acids 14 to 189 (176 residues), 94.6 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3900)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTR1 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Dshi_3900 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MTQSKIAVVAGGSAGVGRATVEKLIAEGYKVGVLARGEDRLAEMEETYGPQVMTLPCDVS
DAAQVSRAATLIEEGLGPIDLWINCAMLTSFSPFTEMKDDEFRAIVDTTFMGVVNGTRAA
LAQMEPRGRGQIVTLGSGLGYRAVPFQSAYCASKHAINGFVASVRSELIRKNAGITMSLV
QLPALNTPQFDWARNRLETKPQPAPPIYQPEVAADAVMRAVHKGSRELFVGASVLQLVFG
NMLLPDYLDKKMSTSGAEMQKSDRDAQGTSDDNLHGPVDSIPASAHSSYGERAKASGLIV
DADLARLAVFGGLIVGTAVLSRLLPRR