Protein Info for Dshi_3861 in Dinoroseobacter shibae DFL-12

Annotation: UDP-glucose 6-dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 13 to 29 (17 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 11 to 389 (379 residues), 335.2 bits, see alignment E=2.5e-104 PF03721: UDPG_MGDP_dh_N" amino acids 11 to 178 (168 residues), 109.2 bits, see alignment E=2.8e-35 PF00984: UDPG_MGDP_dh" amino acids 202 to 291 (90 residues), 91 bits, see alignment E=6.7e-30 PF03720: UDPG_MGDP_dh_C" amino acids 311 to 386 (76 residues), 39.3 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 66% identical to UDG8_ECOLX: UDP-glucose 6-dehydrogenase (ugd) from Escherichia coli

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to dsh:Dshi_3861)

MetaCyc: 65% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTM2 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Dshi_3861 UDP-glucose 6-dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPLDCADGPFMKIAVAGIGYVGLSLSVLLAQRHEVVALDISQERVARLNAGTAPIADPEI
EAYLVEKTLDLTATTDPATAFAGARFIVVATPTSYDPETNRFDTSSVEQVVETALALAPE
ATIVIKSTIPVGFTRALRDRLGVENILFSPEFLREGKALWDNLHPSRIVVGGAGEAARVF
ADLLVEGALDRDVPVLFTRPTEAEAIKLFANTYLAMRVAYFNELDSYALAHGLDSRSVIE
GVCHDPRVGNHYNNPSFGYGGYCLPKDTKQLLANYAAVPQNMISAIVEANTTRKDFIAEQ
VLALAPKSVGIYRLVMKAGSDNFRDSSIQGIMKRLKAKGIEVTVFEPELPDETFFNSRVE
RDLAAFKAGADVIVANRMDDAIRDVAEKVFTRDLFGES