Protein Info for Dshi_3812 in Dinoroseobacter shibae DFL-12

Annotation: homogentisate 1,2-dioxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 22 to 444 (423 residues), 626.9 bits, see alignment E=7.9e-193 PF20510: HgmA_N" amino acids 23 to 291 (269 residues), 361.2 bits, see alignment E=3.5e-112 PF04209: HgmA_C" amino acids 293 to 444 (152 residues), 237.8 bits, see alignment E=4.3e-75

Best Hits

Swiss-Prot: 66% identical to HGD_RHIME: Homogentisate 1,2-dioxygenase (hmgA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 100% identity to dsh:Dshi_3812)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTH5 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Dshi_3812 homogentisate 1,2-dioxygenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MNTQAQVSGLTRAATPMGTTEGYMPGFGNDFETEALPGALPQGMNSPQKCNYGLYGEQLS
GTAFTDVRPERTWCYRIRPSVKHSHRYRRVELPYFRSAPDIHPEVTSLGQYRWDPVPHTD
APLTWLTGMRTMTTAGDVNTQVGMAAHVYLVTESMQDAYFYSADSEMLVVPQEGRLRFAT
ELGIIDLEPKEIAILPRGLLYRVELLDGPARGFVCENYGQKFELPGRGPIGANCMANPRD
FKTPVAAFEDREVPSTVTVKWCGQFHETQIGQSPLDVVAWHGNYAPCKYDLRNYCPVGAI
LFDHPDPSIFTVLTAPSGQPGTANIDFVLFRERWMVAEDTFRPPWYHKNIMSELMGNIYG
QYDAKPQGFVPGGISLHNMMLPHGPDRDAFEKASNANLGPDKLDNTMSFMFETRFPQHLT
RFAGTEAPLQDDYIDCWKDIEKKFDGTPGKK