Protein Info for Dshi_3799 in Dinoroseobacter shibae DFL-12

Annotation: HupE/UreJ protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details PF04955: HupE_UreJ" amino acids 15 to 193 (179 residues), 202.4 bits, see alignment E=2.2e-64

Best Hits

Swiss-Prot: 48% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to dsh:Dshi_3799)

Predicted SEED Role

"Nickel-binding accessory protein UreJ-HupE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTG2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dshi_3799 HupE/UreJ protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MLHRVLPAVLAVLILVSLSAMPALAHETHGHGGGFVAGFTHPILGWDHVAAMVAVGLWGA
FLGAPAIWILPVVFPLVMALGAVLGIAGVPVPAIETGIALSAVVLGLMIAFVVRPPLWVA
AVIVGLFAVFHGYAHGTELPGTVNAFAYAVGFVISTGLLHMIGIAFGLAIKWPAGRMAVR
GAGGLISIAGVAFLTGMA