Protein Info for Dshi_3709 in Dinoroseobacter shibae DFL-12

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 237 to 253 (17 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details amino acids 310 to 343 (34 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details PF06808: DctM" amino acids 6 to 414 (409 residues), 347.2 bits, see alignment E=6.4e-108 TIGR00786: TRAP transporter, DctM subunit" amino acids 13 to 418 (406 residues), 383.8 bits, see alignment E=4.3e-119

Best Hits

Swiss-Prot: 37% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3709)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LT73 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Dshi_3709 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MVPLSFGLLLFAGVPIALVLAITAMIYIWASGNDVLFLSYPQQLYGGLEKYGLLAIPLFM
LVGELMNEGGITKRLVKFASVFVGSLRGGLAYINLVANMFMAAIIGSTNAQIAVMGHVMV
PEMVKRGYDRNFAAAVTAAGGLMSPIIPPSMLFVIYGVLAQISIGDMFIAGIIPGLLMGA
AFILVVVVLGFFYTYPTEAKLSRGMAVSHILRALPSLSIPVVIIGGIAGGIATPTESAAV
ASVAAIIVGWAFHREFDPSHIPGMLVRLLASSSMVLFLVATANVFGWIIVYEKIPQNLAA
YLVTLTENPIVFMLLLNVMLLLVGTVIDAIAALILVVPIMLPIAMLSYGIDPFHFGVAVC
LNLVIGLLTPPVGTALYVTAQVSNCKPMSIMKPLAPFLLAALVILLLVSVWPALTLVLID