Protein Info for Dshi_3673 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details PF20340: DUF6635" amino acids 27 to 111 (85 residues), 99.4 bits, see alignment E=1e-32 amino acids 157 to 321 (165 residues), 155.8 bits, see alignment E=6.2e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3673)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LT39 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dshi_3673 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MITSSPTEAAPRTPETLDLPDYIQTLRHAVDPFVAEHFSWRGTLRLHRNALGWDIFRAPV
NIILSPVFVLTRIVAYLCNRLGLRRGGAWLARRRILLRTSVARRVETCIIADLLGLPVTA
GKTAFDQTTLEHAVLAAPQFRETLRRCENADDARALSHRVLGAVSEYAGTRSAVSEITTV
LFTLLTGAVVFQALTPGMISMAPGVAEAMAHTTAIANFPLGQTIGGAWYGVFATDTSPWL
VVATLAVLVMLGSIFAAFVGILADPVQSRLGIHRRRLLRLIDTIEVELDGAGEKPFVARE
HYYARAFDLWDAGASLLRVFRN