Protein Info for Dshi_3663 in Dinoroseobacter shibae DFL-12

Annotation: putative membrane protein of unknown function (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF13194: DUF4010" amino acids 71 to 279 (209 residues), 138.2 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3663)

Predicted SEED Role

"putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>Dshi_3663 putative membrane protein of unknown function (RefSeq) (Dinoroseobacter shibae DFL-12)
MLAAGAAVVIASLLAAREMLQGFSRSILTAAELRDGLILGVSILVILPILPSLEIGPGGA
LNPRNLFIIVVVIMLIGAAGHIATRVIGARLGLPISGFLSGFVSSTSTIVALGQRATEKP
EDARSAAAGATLSSVSSLIQIGIILLALSPAMFTMGLPLLFGAAGAAALHGAAIFFLALR
RKVEPAVLELPSQVFSIKAAAGFALIVAVVMLTSATLNDVFGNTAVLATVALAGLVSTNS
ATVALASLVAAGQISAVDGALPLAAALSANTIARLLIAWRGKNVTFRRIVAFGLVLQLAA
LWLSWWLAALLRSWFADWSAIISQ