Protein Info for Dshi_3662 in Dinoroseobacter shibae DFL-12

Annotation: putative transposase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF14319: Zn_Tnp_IS91" amino acids 11 to 102 (92 residues), 116.7 bits, see alignment E=3.9e-38 PF04986: Y2_Tnp" amino acids 144 to 331 (188 residues), 224.1 bits, see alignment E=1.5e-70

Best Hits

Swiss-Prot: 62% identical to Y4QJ_SINFN: Putative transposase y4qJ (NGR_a01880) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3662)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>Dshi_3662 putative transposase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPRPRLEVADIFRDHGPAYRREHAGHLNLPQLKVMSAIENCRTAALGGHVAACTECDHQH
IAYNSCRNRHCPKCQGATAKDWMQARIEDLLPVEYFHVVFTLPAQIADIAFQNKAEVYGL
LFKASAQTLLTIAADPKHLGARIGMTSVLHTWGSAMTHHPHVHVIVPGGGLSPDGSRWVA
CRPGFFLPVKVLSQLFRRLFLEGLIRLHQTGKLAFFGELAGLADPDAFASHLAPLRKASW
VVYAKPPFGGPEAVLAYLSRYTHRVAISNHRLVSADAETVAFRWKDYRIKRGDRMKVMRL
PTGEFIRRFLIHVLPSGFHRIRHTGFLANGIRRDRIAEIRRLLNTEPKPGQTPVEGESDN
PAGLDAHQPCPKCDGAMIVIETFTRGQTPRSRAPPRENAA