Protein Info for Dshi_3545 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details PF12291: DUF3623" amino acids 3 to 258 (256 residues), 343.2 bits, see alignment E=4.1e-107 TIGR03055: putative photosynthetic complex assembly protein 2" amino acids 8 to 253 (246 residues), 296 bits, see alignment E=1e-92

Best Hits

Swiss-Prot: 52% identical to YPU2_RHOCA: Uncharacterized 30.4 kDa protein in puhA 5'region from Rhodobacter capsulatus

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3545)

Predicted SEED Role

"FIG00444485: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ38 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Dshi_3545 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MFSSPWIIALCAMFIWWFATGAILCIVKHADRRGPRAHLRSVILTAPFGLLGVYGFSASL
TEATVPGVWIAFASALLVWGWIEHAFLAGIITGPNSYDCPEGCSEFERFFRAWGTIAYHE
MLLLTVLIVMGITAWGADNKFGFWTFSVLFIARISAKLNLFLGVRKINTEFLPTPLSHLP
SHFRIRPINWLFPYSVTALTFAMTCWFERLYAAETAAATVGFTLLAVFTALALLEHWLMV
VPLPDEKLWRWLMPAKDMPAKEKQG