Protein Info for Dshi_3533 in Dinoroseobacter shibae DFL-12

Annotation: 2-vinyl bacteriochlorophyllide hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02020: 2-vinyl bacteriochlorophyllide hydratase
  • amino acids 14 to 155 (142 residues), 186.7 bits, E=1.2e-59
• PF07284: BCHF
  • amino acids 15 to 153 (139 residues), 211.3 bits, E=2.8e-67

Best Hits

Swiss-Prot: 71% identical to BCHF_RHOCB: 2-vinyl bacteriochlorophyllide hydratase (bchF) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K11336, 3-vinyl bacteriochlorophyllide hydratase [EC: 4.2.1.-] (inferred from 100% identity to dsh:Dshi_3533)

MetaCyc: 71% identical to chlorophyllide a hydratase (Rhodobacter capsulatus)
RXN-8785 [EC: 4.2.1.165]; 4.2.1.165 [EC: 4.2.1.165]

Predicted SEED Role

"2-vinyl bacteriochlorophyllide hydratase BchF (EC 4.2.1.-)" in subsystem Carotenoids or Chlorophyll Biosynthesis (EC 4.2.1.-)

MetaCyc Pathways

• superpathway of bacteriochlorophyll a biosynthesis (20/26 steps found)
• bacteriochlorophyll a biosynthesis (8/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.165

Sequence Analysis Tools

See A8LQ26 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Dshi_3533 2-vinyl bacteriochlorophyllide hydratase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSTGLNTQENRVGLYTPEQKKRRDESVWTLIQGILAPLQFLVFAISLVLVVRYMMTGEGY
VLASISILIKTGFLYAIMITGAIWEKVVFGQYLLAPAFFWEDVVSFFVIALHTLYVWAFL
SGTIPPQGQMLIALAAYLVYVVNAGQFLWKLRMARLQAEAMA