Protein Info for Dshi_3513 in Dinoroseobacter shibae DFL-12

Annotation: Zeta-phytoene desaturase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01266: DAO" amino acids 12 to 494 (483 residues), 37 bits, see alignment E=1.2e-12 PF00890: FAD_binding_2" amino acids 13 to 47 (35 residues), 26.1 bits, see alignment 2e-09 TIGR02734: phytoene desaturase" amino acids 13 to 507 (495 residues), 262.8 bits, see alignment E=3e-82 PF13450: NAD_binding_8" amino acids 15 to 68 (54 residues), 40.9 bits, see alignment 8.1e-14 PF01593: Amino_oxidase" amino acids 20 to 301 (282 residues), 93.7 bits, see alignment E=6.6e-30 amino acids 429 to 497 (69 residues), 22.3 bits, see alignment E=3e-08

Best Hits

Swiss-Prot: 60% identical to CRTD_RHOS4: Hydroxyneurosporene desaturase (crtD) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K09845, methoxyneurosporene dehydrogenase [EC: 1.14.99.-] (inferred from 100% identity to dsh:Dshi_3513)

Predicted SEED Role

"Methoxyneurosporene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-

Use Curated BLAST to search for 1.14.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ06 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Dshi_3513 Zeta-phytoene desaturase (RefSeq) (Dinoroseobacter shibae DFL-12)
MDRNVMTRAQDKVVVIGAGMGGLASAIRLAHAGCDVTVLEALSGPGGKMRTLPSAAGPVD
AGPTVMTLRPIFESLFADVEAGLSDYVTLHRETVLARHWWSDGSTLDLFSDAEASEAAVR
AFAGAREAAAFAAFSAQAAKLFAAFDGPMMQNPAPDLAGLTRHVLAQPSVIPAMGPLTTL
ARSLAKRFRDPRLQQLFGRYATYVGGSPYASPAVLALIWQAEAQGVWRVEGGMHALAQGL
ARLAAEKGADLRYDTCVARIETQGGRVAGVHLTDGARIAADTVVFNGDPRALHLGLLGPA
AKPAVAAPGVAERSLSAYVWSFAGQPEGRDLVHHNVFFADDPAREFDDLAAGRMPRDATL
YLCAEDRGAGLTPAGPERFEVIMNGPPVAGAAGLRDDHEEFHACQTQVFTRFAAMGLRFP
ERPGREALTMPRDFARLFPGSAGSLYGRSPHGLMAAFQRPQARTKLPGLYLAGGGAHPGA
GIPMATLSGKHAAAAILSDRTSTSTFRPTATRGGISTGSATAAPARSRSSLS