Protein Info for Dshi_3512 in Dinoroseobacter shibae DFL-12

Annotation: hydroxyneurosporene synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 62% identical to CRTC_RHOS4: Acyclic carotenoid 1,2-hydratase (crtC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K09844, hydroxyneurosporene dehydrogenase (inferred from 100% identity to dsh:Dshi_3512)

Predicted SEED Role

"Hydroxyneurosporene dehydrogenase (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See A8LQ05 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Dshi_3512 hydroxyneurosporene synthase (RefSeq) (Dinoroseobacter shibae DFL-12)
MATYGPGGRWTMTDRGRSALRQSPERFEVGPSVLHWDGDRLVVEINEISTPHGQRVQGTV
TIHPSALTSVEVPLTADGAHVWRPFAPTAEIEVDLGKDGWSWRGHGYFDANFGTRALEED
FGYWTWGRYPTRVGTASFYDVARRDGSDLAVALSFGRDGSVETLEAPPKTRFSRSLWAIK
RETRADPGTKPRQVKHMLDAPFYNRCGVETTLHGERVTGVFEALDLDRFRGPWLMPMLAV
RVPRRSKWAFKD