Protein Info for Dshi_3502 in Dinoroseobacter shibae DFL-12

Annotation: magnesium chelatase ATPase subunit I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02030: magnesium chelatase ATPase subunit I" amino acids 5 to 333 (329 residues), 531.4 bits, see alignment E=4.4e-164 PF01078: Mg_chelatase" amino acids 110 to 180 (71 residues), 31.6 bits, see alignment E=1.6e-11 PF17863: AAA_lid_2" amino acids 260 to 322 (63 residues), 56.1 bits, see alignment E=3.7e-19

Best Hits

Swiss-Prot: 77% identical to BCHI_RHOS4: Magnesium-chelatase 38 kDa subunit (bchI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 100% identity to dsh:Dshi_3502)

MetaCyc: 77% identical to BchI (Cereibacter sphaeroides)

Predicted SEED Role

"Protoporphyrin IX Mg-chelatase subunit I (EC 6.6.1.1)" in subsystem Chlorophyll Biosynthesis (EC 6.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.6.1.1

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPZ5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Dshi_3502 magnesium chelatase ATPase subunit I (RefSeq) (Dinoroseobacter shibae DFL-12)
MTHPFPFSAIVGQSEMKQAMVLTAIDPSIGGVLVFGDRGTGKSTSVRALAALLPEIDVVA
GCPCNSATPAAVPDWAEGVGTEIVSKPTPVIDLPLGATEDRVVGALDIERALTRGEKAFE
PGLLARANRGYLYIDEVNLLEDHIVDLLLDVAVSGENVIEREGLSIRHPARFVLVGSGNP
EEGELRPQLLDRFGLSVEVASPNNIDDRIEVIRRRDAYEMDYDAFMAHWQGEDASLRKRI
LEARKILRAIETPDATLRDCAELCVALGADGLRGELTLLKAARAVAAYSGAETVGREHLR
TIAASALRHRLRRDPLDEAGSTTRVARVVDSVLA