Protein Info for Dshi_3490 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 41 to 309 (269 residues), 59.9 bits, see alignment E=3.3e-20 PF00005: ABC_tran" amino acids 378 to 532 (155 residues), 122.1 bits, see alignment E=2.7e-39

Best Hits

Swiss-Prot: 52% identical to Y1051_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1051 (HI_1051) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to dsh:Dshi_3490)

Predicted SEED Role

"ABC transporter, transmembrane ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPF8 at UniProt or InterPro

Protein Sequence (614 amino acids)

>Dshi_3490 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MFRFFERLVDPYVAYPETDCPPTRLWPFMLSWSRPFRGLFVVAGVMSLLVAAVEIALIYY
MGRVVDLLSTSSPATVWADHGTELIFVALFILLFRPALQALDVLLLNNAILPNYGTLFRW
RAHRQVLRQSVGWFENDFAGRIANRIMQTPPAAGEAVFQVFDAISFALAYLIGAAILLAG
ADPRLAIPLIVWFVLYGALVRWTIINVGPASKASSDARSETTGRVVDAYTNIHAVKLFAH
HDRELAYAKDAIEKTRTTFAREMRIFTTMDIVLVILNGLLIVGVVGWAILMWVQGTASVG
VVAAATALTLRLNAMTGWIMWAVSTFFQNLGVIAEGMETIAQPITLVDAPNAGPLSLTKG
EITLDRLSHHYGQGAGGLDAISLTLKPGEKVGLVGRSGAGKSTLVKLLLRFYDPDGGRVL
IDGQDIATVTQDSLRARIGMVQQDSALLHRSVRDNILYGRPEATEAEMIAAAKRAEAHDF
IQTLRDPQGRTGYDAHVGERGVKLSGGQRQRITLARVILKDAPILILDEATSALDSEVEA
AIQNTLYGVMEGKTVIAIAHRLSTIAQMDRILVLDEGRVIEDGTHAGLLAAGGLYASFWA
RQSGGFINTAEAAE