Protein Info for Dshi_3483 in Dinoroseobacter shibae DFL-12

Annotation: molybdate ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 3 to 354 (352 residues), 419.7 bits, see alignment E=5.4e-130 PF00005: ABC_tran" amino acids 25 to 161 (137 residues), 102.5 bits, see alignment E=3e-33 PF03459: TOBE" amino acids 294 to 354 (61 residues), 40.5 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 53% identical to MODC_RHILO: Molybdenum import ATP-binding protein ModC (modC) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to dsh:Dshi_3483)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPF1 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Dshi_3483 molybdate ABC transporter, ATPase subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTLSVRINHGFPGFALDVAFDAPPGITALFGKSGSGKTSVVNAVAGLLRPDAGTIRVADR
LLFDAERRICVPTHRRRLGYVFQEGRLFPHLTVRQNLCYGRWFAKGRAGSDPIDRIVELL
GIGPLLDRQPGALSGGEKQRVAIGRALLSEPELLLMDEPLAALDSARKAEILPYIQRLRD
ETDTPILYVSHSVPEVARIATTVVALEAGRVLRSGPAQAVLADPDVAPALGIREAGALLS
GIVREHAEDGVTALAFSGGTLYLPLQRDPVGADLRVRIEAKDVLLATEAPTGLSALNIFP
ARIEKLRQGDGPGVLVQLRIGTDLVLSRVTRRSANRMGLAVGQSCYAVLKTVSVAKQDIG