Protein Info for Dshi_3474 in Dinoroseobacter shibae DFL-12

Annotation: fumarate lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00206: Lyase_1" amino acids 95 to 286 (192 residues), 93.8 bits, see alignment E=7.1e-31

Best Hits

KEGG orthology group: K01857, 3-carboxy-cis,cis-muconate cycloisomerase [EC: 5.5.1.2] (inferred from 100% identity to dsh:Dshi_3474)

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPE2 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Dshi_3474 fumarate lyase (RefSeq) (Dinoroseobacter shibae DFL-12)
MAAGGQNRLFDGLFADPEIAALFSAETMFAHFRHYEMALTEAQGAVGRVKDAARIAARIA
KFEIAPDAISDRVTQDGVPVPAYVAALEAALGVDAAAVHLDATSQDLMDTSLALSLRRLS
EVLAARLDRVIVALDGLQAAQGARTLMGRTRMQAALPIPVATRLEAWQTPLLRARDRFPE
ARAGVEQLQFGGPVGQRSPQMAAIAERLAKALDLPPPGPVWHSTRDGVVGYGTWLALVTG
SLGKMGQDIALMSQQGLDDARLSGGGTSSAMPHKQNPIAAETLVTLARFNAVQIGGLHQA
MVHEQERSGAAWALEWMILPQICEATGAALRHAAALLDSIETLGKKPV