Protein Info for Dshi_3456 in Dinoroseobacter shibae DFL-12

Annotation: methyltransferase GidB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to RSMG_DINSH: Ribosomal RNA small subunit methyltransferase G (rsmG) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to dsh:Dshi_3456)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPC4 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dshi_3456 methyltransferase GidB (RefSeq) (Dinoroseobacter shibae DFL-12)
MDAASRCDLKVFERLIRKWSPRINLVAPSTYDQTWERHILDSAQLYDFLPSTADKVIDLG
SGGGLPVVVLGVLAKHRGCRIKFTAIESDARKCAFLRTAARELQINLSVITSRIEAANVE
PGNVITARALAPVSKLLEFAEPLRVAGGTCLFLKGENVQNEVSEAKNSWQFEAKYYPSVT
SEKSAILEIGEFYRA