Protein Info for Dshi_3451 in Dinoroseobacter shibae DFL-12

Annotation: maf protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00172: septum formation protein Maf" amino acids 2 to 190 (189 residues), 121.9 bits, see alignment E=1.1e-39 PF02545: Maf" amino acids 3 to 190 (188 residues), 151.6 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 63% identical to NTPP_RUEPO: Nucleoside triphosphate pyrophosphatase (SPO3892) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to dsh:Dshi_3451)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPB9 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dshi_3451 maf protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTHIILASGSEIRRQLLENAGVSVRVIKAKIDEETITQSLRAEGAKARDVADALAEFKAE
KVARLEPEALVIGSDQVLDLQGELLAKPETPEHAIAQITAMSGKTHQLLSAAVIYGEGKP
LWRHVGAVRMTVRSLSPSYIESYVARNWDSIRHSVGGYKLEEEGVRLFSQVQGDYFTVLG
LPLLELLSYLTLRGEIDG