Protein Info for Dshi_3433 in Dinoroseobacter shibae DFL-12

Annotation: PAS domain containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12860: PAS_7" amino acids 183 to 295 (113 residues), 41.3 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3433)

Predicted SEED Role

"FIG056333: sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPA1 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Dshi_3433 PAS domain containing protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MAGMDFTLLATLLAVAFLTAALALYALNTLSNRDFAQGPGPTLPVRTDLDGPSADQITAQ
RRELAQLRATVEHIPLILWRQDNDGALTWANKPYIDLTEKLHPDRAGRWPMPHLFKQKSL
AHPDTPGHRRISIDMEDGEKRWFEVQGFRVQDEILYSATPIDMTVKAEVSLRNFVQTLTS
TFAHLQVGLAIFDKRRQLVLFNPALTDLTTLEPEWLSARPGLSEVLDRLRDKNMLPEPKD
YKEWRNRLTGLEKAASSGTFEETWALPTGQNYRILGRPHHDGGIALTFEDISSEVSLTRR
FRSEIELGQTALDTLEEAIAVFSENGTLVLSNKAYSELWDVSENDGLMPVSIVDATRHWQ
QSCQPNPIWGDIRDFATTSQGRADWEDYARLQDGGTILRCRVAPLAQGMTLVGFKTLEAV
PEFQPAKTEIAQTA