Protein Info for Dshi_3410 in Dinoroseobacter shibae DFL-12

Annotation: periplasmic protein thiol--disulphide oxidoreductase DsbE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 8 to 164 (157 residues), 150.9 bits, see alignment E=1.3e-48 PF00578: AhpC-TSA" amino acids 39 to 157 (119 residues), 45.5 bits, see alignment E=1.1e-15 PF08534: Redoxin" amino acids 42 to 175 (134 residues), 54.8 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to dsh:Dshi_3410)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP78 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Dshi_3410 periplasmic protein thiol--disulphide oxidoreductase DsbE (RefSeq) (Dinoroseobacter shibae DFL-12)
MKRALFALPVVLVLILGGFFLWGLNPDRDPNAIPSVLIDAQAPEFALDGIPGLDTPGLAK
ADLSGADNPLVVNVFASWCVPCRAEHAVLTRMAREENIHLLGINYKDKPEDAVRWLDELG
NPYERIGADLTGRVGIEWGISGVPETFVIDANGIVVYRFVGPILSAEDVRDMQEAIALAR
SRSGAGGTS