Protein Info for Dshi_3396 in Dinoroseobacter shibae DFL-12

Annotation: Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF04290: DctQ" amino acids 42 to 172 (131 residues), 52.7 bits, see alignment E=2.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3396)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNN5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Dshi_3396 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq) (Dinoroseobacter shibae DFL-12)
MEPVEEIIKLSDPGEVGREEHNRGDRVIVQISNVMAWLFPILMVAIVAQVFLRGSGMNQA
WLDDLQWWLYGSAVLVGIGYAVTNNAHVRVDILFDNFGSDKKNRIEIFGLVWLFLPFIIL
CWDVTLPYAIASVSANEGSDSPNGLHNLWMLKVFMNVSFAFIGIAIWSAYVRFLNKMTEP
VLWKQLLFAFPSTMFLINLVVYYSIWWALRLTTPADVTNREIGRHPIFDELQVGVEEIPY
TIIITVIVTFIVIGLAYARDRAREARY