Protein Info for Dshi_3378 in Dinoroseobacter shibae DFL-12

Annotation: flagellar hook-associated protein FlgK (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 6 to 484 (479 residues), 224.6 bits, see alignment E=1.6e-70 PF00460: Flg_bb_rod" amino acids 9 to 36 (28 residues), 28 bits, see alignment (E = 2.5e-10) PF22638: FlgK_D1" amino acids 101 to 312 (212 residues), 114.2 bits, see alignment E=1.1e-36 PF06429: Flg_bbr_C" amino acids 448 to 484 (37 residues), 33.4 bits, see alignment 3.8e-12

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 100% identity to dsh:Dshi_3378)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNL7 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Dshi_3378 flagellar hook-associated protein FlgK (RefSeq) (Dinoroseobacter shibae DFL-12)
MSVTSTLGNALSGLTAASKAASVVSSNIANATTEGYGVRQVQTTSVSLNGQGSGVQVVSV
SRNVNEGVLADRRAADAAYAQAATLASFYGSVEGAIGLPGDEGSLSSEFSQFEAALVEAG
SRPDSDARLANVVRAAESLAGTLNDLSADIQSERLEAEKEIARQVDNLNTSLAQIQDLNG
DIRLQIAAGNDPLGLMDQRQVLIDQIATIVPVSVVDRDFGQVALITESGGVLLDGTAAEI
SFRDVGLITPDMTVASGGLYQVEINGSPVDSTSPNNPLKGGSLDALFEIRDELAVSAQGD
VDAVARDLIERFQNSAIDPTLSAGEPGLFTDAGALVDPANEVGLAGRIELNARVDPAKGG
EVWRVRTGLGATSPGDPGAGGIILALSDALSEPKVVASGSFSSIPRTAAALASDLLSTIG
AARQASENEVSYTAAKWETLRSLELEGGVDTDAELQKLLMIETAYAANARVIQTVDEMLD
LLLRI