Protein Info for Dshi_3354 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00005: ABC_tran" amino acids 22 to 167 (146 residues), 113.2 bits, see alignment E=7.7e-37

Best Hits

Swiss-Prot: 46% identical to LOLD_RHOFT: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to dsh:Dshi_3354)

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNJ3 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Dshi_3354 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MVLQLRGVTKTYETGDGPLPVLRGVDLGLNAGETLALTGESGSGKSTLLHLVGGLDTPDA
GTIEVAGANVGAMGDEARAALRRGTVGVVFQQFNLIPALDVAANLSFQARLAGHDEPAHW
VDLAERLGLTPFLRRYPEQLSGGQQQRVAIGRALAARPRLLLADEPTGNLDETTADAVLT
LMLDLVRESDTALLMVTHSDRVAERMARRIHLRLGKVA