Protein Info for Dshi_3340 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 13 to 196 (184 residues), 94.6 bits, see alignment E=3.4e-31 PF02592: Vut_1" amino acids 32 to 195 (164 residues), 103.8 bits, see alignment E=6.1e-34

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to dsh:Dshi_3340)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNH9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Dshi_3340 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTRIHLPGIVAMAAIVVASNILVQFLFGNWLTWGAFTYPLAFLVTDLMNRLYGAQAARRV
VAVGFAVGVVCSLIGTQIMGEFGPLVTLRIAIGSGLAFLTAQLVDIAVFNRLREGSWWRA
PLASTLVGSSLDTAIFFTIAFSGALTFLEPTNDVSWAGEAVPLLGLGPVAPLWVSLAVAD
LMVKLSLAILALIPFRVILRRLRPNLA