Protein Info for Dshi_3323 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, GntR family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00392: GntR" amino acids 22 to 82 (61 residues), 64 bits, see alignment E=7.9e-22 PF07729: FCD" amino acids 94 to 215 (122 residues), 77.6 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3323)

Predicted SEED Role

"Predicted regulator PutR for proline utilization, GntR family" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNG2 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Dshi_3323 transcriptional regulator, GntR family (RefSeq) (Dinoroseobacter shibae DFL-12)
MPVEREPEMNLAKPIARPSLHAELVDRVRELIIEGSLEPGTKIPEKELCQSFGVSRTPMR
EALKVLANEGLAVLEPNRGAWVSTVTMEELEETFPVIAALERLAGELACAHGSDAQIAHI
RTRHDDMMACFATRNRQAYFKANQDIHDGILEAAGNEVLSQHHRVLGSRVKRARFLANIS
DARWAQAVAEHEGIITALEARDGPLLGQLLSAHLGNKFAALKARMN