Protein Info for Dshi_3322 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, LacI family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00356: LacI" amino acids 14 to 59 (46 residues), 62.9 bits, see alignment 3.8e-21 PF13407: Peripla_BP_4" amino acids 73 to 273 (201 residues), 49 bits, see alignment E=1.3e-16 PF00532: Peripla_BP_1" amino acids 73 to 328 (256 residues), 89.1 bits, see alignment E=7.3e-29 PF13377: Peripla_BP_3" amino acids 182 to 339 (158 residues), 67.8 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to dsh:Dshi_3322)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNG1 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Dshi_3322 transcriptional regulator, LacI family (RefSeq) (Dinoroseobacter shibae DFL-12)
MNDVSAPPARRPLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRAKVQEAARALGYVPNK
IAGALASNRVNLVAVIIPSMSNMVFPEVMGGISSVLEETELQPVVGITDYLPEKEEKVLY
EMLSWRPSGVIIAGLEHTEAARAMLRNSGIPVVEIMDTDGNPTDCAVGISHRRAGREMGE
AILEAGYRRIGFMGTKMALDHRARKRYEGFVEALAKGGVELADWEFYEGGSALAKGRELT
AAMLERTPDLDFLYYSNDLIGAGGLLYCTEKGMDIPGSFGMAGFNGVELLRGLPVTLATI
DSCRREIGRTAADMIVARMEGATSSEVVTLTPKLQPGDTMRLSAP